Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4217115..4217631 | Replicon | chromosome |
| Accession | NZ_LR890632 | ||
| Organism | Klebsiella pneumoniae isolate INF299-sc-2280084 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | JMX65_RS20920 | Protein ID | WP_040216106.1 |
| Coordinates | 4217347..4217631 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | JMX65_RS20915 | Protein ID | WP_064162488.1 |
| Coordinates | 4217115..4217357 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX65_RS20900 | 4213143..4213883 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| JMX65_RS20905 | 4213950..4215104 | + | 1155 | WP_064162489.1 | lactonase family protein | - |
| JMX65_RS20910 | 4215127..4217037 | + | 1911 | WP_023325426.1 | BglG family transcription antiterminator | - |
| JMX65_RS20915 | 4217115..4217357 | + | 243 | WP_064162488.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMX65_RS20920 | 4217347..4217631 | + | 285 | WP_040216106.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX65_RS20925 | 4217635..4218099 | - | 465 | WP_064162487.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMX65_RS20930 | 4218407..4220545 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMX65_RS20935 | 4220902..4221645 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| JMX65_RS20940 | 4221648..4221821 | - | 174 | WP_032425422.1 | hypothetical protein | - |
| JMX65_RS20945 | 4221906..4222214 | + | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11097.94 Da Isoelectric Point: 10.4962
>T291643 WP_040216106.1 NZ_LR890632:4217347-4217631 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|