Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2801174..2801831 | Replicon | chromosome |
Accession | NZ_LR890632 | ||
Organism | Klebsiella pneumoniae isolate INF299-sc-2280084 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | JMX65_RS13915 | Protein ID | WP_040245400.1 |
Coordinates | 2801174..2801584 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | JMX65_RS13920 | Protein ID | WP_002916312.1 |
Coordinates | 2801565..2801831 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX65_RS13895 | 2797174..2798907 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
JMX65_RS13900 | 2798913..2799626 | - | 714 | WP_048290928.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
JMX65_RS13905 | 2799649..2800545 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
JMX65_RS13910 | 2800646..2801167 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
JMX65_RS13915 | 2801174..2801584 | - | 411 | WP_040245400.1 | protein YgfX | Toxin |
JMX65_RS13920 | 2801565..2801831 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
JMX65_RS13925 | 2802077..2803060 | + | 984 | WP_032430613.1 | tRNA-modifying protein YgfZ | - |
JMX65_RS13930 | 2803211..2803870 | - | 660 | WP_048334397.1 | hemolysin III family protein | - |
JMX65_RS13935 | 2804034..2804345 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
JMX65_RS13940 | 2804395..2805123 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
JMX65_RS13945 | 2805242..2806675 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16035.83 Da Isoelectric Point: 11.4778
>T291640 WP_040245400.1 NZ_LR890632:c2801584-2801174 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDSRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDSRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|