Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 223779..224689 Replicon plasmid 2
Accession NZ_LR890625
Organism Klebsiella pneumoniae isolate INF242-sc-2280140

Toxin (Protein)


Gene name - Uniprot ID R4YBC5
Locus tag JMX20_RS26270 Protein ID WP_004144067.1
Coordinates 223779..224249 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag JMX20_RS26275 Protein ID WP_004026357.1
Coordinates 224246..224689 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX20_RS26235 219090..219356 - 267 WP_003026799.1 DUF1778 domain-containing protein -
JMX20_RS26240 219489..219917 - 429 WP_004901287.1 GFA family protein -
JMX20_RS26245 220118..220264 - 147 WP_159193595.1 IS3 family transposase -
JMX20_RS26250 220286..221406 + 1121 WP_101837575.1 IS3 family transposase -
JMX20_RS26255 221433..222248 - 816 WP_077268817.1 IS3 family transposase -
JMX20_RS26260 222203..222712 - 510 WP_004901294.1 IS3 family transposase -
JMX20_RS26265 223408..223668 + 261 WP_048291871.1 hypothetical protein -
JMX20_RS26270 223779..224249 - 471 WP_004144067.1 RES family NAD+ phosphorylase Toxin
JMX20_RS26275 224246..224689 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
JMX20_RS26280 224790..225296 - 507 Protein_212 DUF4113 domain-containing protein -
JMX20_RS26285 225397..225618 - 222 WP_072060588.1 DUF2188 domain-containing protein -
JMX20_RS26290 226042..226779 + 738 Protein_214 DUF1311 domain-containing protein -
JMX20_RS26295 226779..227120 + 342 WP_048291869.1 hypothetical protein -
JMX20_RS26300 227515..228560 + 1046 Protein_216 IS3 family transposase -
JMX20_RS26305 228615..228989 + 375 WP_173675457.1 hypothetical protein -
JMX20_RS26310 228919..229143 + 225 WP_127807699.1 DUF4113 domain-containing protein -
JMX20_RS26315 229222..229450 + 229 Protein_219 type II toxin-antitoxin system Phd/YefM family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA 1..233683 233683
- flank IS/Tn - - 227862..228560 698


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17573.83 Da        Isoelectric Point: 4.5152

>T291634 WP_004144067.1 NZ_LR890625:c224249-223779 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT291634 WP_004026357.1 NZ_LR890625:c224689-224246 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A384IED8

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References