Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 218617..219356 | Replicon | plasmid 2 |
| Accession | NZ_LR890625 | ||
| Organism | Klebsiella pneumoniae isolate INF242-sc-2280140 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | JMX20_RS26230 | Protein ID | WP_021312536.1 |
| Coordinates | 218617..219102 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMX20_RS26235 | Protein ID | WP_003026799.1 |
| Coordinates | 219090..219356 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX20_RS26200 | 213761..214198 | - | 438 | WP_201530453.1 | hypothetical protein | - |
| JMX20_RS26205 | 214294..215361 | - | 1068 | WP_048291875.1 | hypothetical protein | - |
| JMX20_RS26210 | 215430..215726 | - | 297 | WP_201530454.1 | hydrogenase expression/formation protein HypD | - |
| JMX20_RS26215 | 215960..216337 | + | 378 | WP_032719541.1 | hypothetical protein | - |
| JMX20_RS26220 | 216534..217508 | - | 975 | WP_048291873.1 | hypothetical protein | - |
| JMX20_RS26225 | 218113..218274 | - | 162 | WP_004118124.1 | type I toxin-antitoxin system Hok family toxin | - |
| JMX20_RS26230 | 218617..219102 | - | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
| JMX20_RS26235 | 219090..219356 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX20_RS26240 | 219489..219917 | - | 429 | WP_004901287.1 | GFA family protein | - |
| JMX20_RS26245 | 220118..220264 | - | 147 | WP_159193595.1 | IS3 family transposase | - |
| JMX20_RS26250 | 220286..221406 | + | 1121 | WP_101837575.1 | IS3 family transposase | - |
| JMX20_RS26255 | 221433..222248 | - | 816 | WP_077268817.1 | IS3 family transposase | - |
| JMX20_RS26260 | 222203..222712 | - | 510 | WP_004901294.1 | IS3 family transposase | - |
| JMX20_RS26265 | 223408..223668 | + | 261 | WP_048291871.1 | hypothetical protein | - |
| JMX20_RS26270 | 223779..224249 | - | 471 | WP_004144067.1 | RES family NAD+ phosphorylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA | 1..233683 | 233683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T291633 WP_021312536.1 NZ_LR890625:c219102-218617 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|