Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 181473..181998 | Replicon | plasmid 2 |
| Accession | NZ_LR890625 | ||
| Organism | Klebsiella pneumoniae isolate INF242-sc-2280140 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | J5VBT8 |
| Locus tag | JMX20_RS26050 | Protein ID | WP_004197633.1 |
| Coordinates | 181693..181998 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | R4WC25 |
| Locus tag | JMX20_RS26045 | Protein ID | WP_015632547.1 |
| Coordinates | 181473..181691 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX20_RS26020 | 176899..177483 | - | 585 | WP_023345591.1 | TetR/AcrR family transcriptional regulator | - |
| JMX20_RS26025 | 177595..177990 | - | 396 | WP_023345592.1 | helix-turn-helix transcriptional regulator | - |
| JMX20_RS26030 | 178093..178938 | + | 846 | WP_023345593.1 | SDR family oxidoreductase | - |
| JMX20_RS26035 | 179051..179479 | + | 429 | WP_023345594.1 | nuclear transport factor 2 family protein | - |
| JMX20_RS26040 | 179821..181194 | - | 1374 | WP_048265005.1 | hypothetical protein | - |
| JMX20_RS26045 | 181473..181691 | + | 219 | WP_015632547.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| JMX20_RS26050 | 181693..181998 | + | 306 | WP_004197633.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| JMX20_RS26055 | 182185..183173 | + | 989 | Protein_167 | hypothetical protein | - |
| JMX20_RS26060 | 183372..184157 | + | 786 | WP_048291886.1 | site-specific integrase | - |
| JMX20_RS26065 | 184479..184784 | - | 306 | WP_126034233.1 | hypothetical protein | - |
| JMX20_RS26070 | 184933..185310 | - | 378 | WP_158672279.1 | DUF1173 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA | 1..233683 | 233683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11585.27 Da Isoelectric Point: 6.4661
>T291632 WP_004197633.1 NZ_LR890625:181693-181998 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MCG5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2L1KT86 |