Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 174928..175571 | Replicon | plasmid 2 |
| Accession | NZ_LR890625 | ||
| Organism | Klebsiella pneumoniae isolate INF242-sc-2280140 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | JMX20_RS26005 | Protein ID | WP_023345587.1 |
| Coordinates | 174928..175344 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | JMX20_RS26010 | Protein ID | WP_023345588.1 |
| Coordinates | 175341..175571 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX20_RS25990 | 170525..171160 | + | 636 | WP_023345584.1 | DUF1349 domain-containing protein | - |
| JMX20_RS25995 | 171549..173423 | + | 1875 | WP_048291888.1 | beta-glucoside-specific PTS transporter subunit IIABC | - |
| JMX20_RS26000 | 173433..174836 | + | 1404 | WP_023345586.1 | glycoside hydrolase family 1 protein | - |
| JMX20_RS26005 | 174928..175344 | - | 417 | WP_023345587.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX20_RS26010 | 175341..175571 | - | 231 | WP_023345588.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMX20_RS26015 | 175989..176831 | - | 843 | WP_048291887.1 | nitroreductase family protein | - |
| JMX20_RS26020 | 176899..177483 | - | 585 | WP_023345591.1 | TetR/AcrR family transcriptional regulator | - |
| JMX20_RS26025 | 177595..177990 | - | 396 | WP_023345592.1 | helix-turn-helix transcriptional regulator | - |
| JMX20_RS26030 | 178093..178938 | + | 846 | WP_023345593.1 | SDR family oxidoreductase | - |
| JMX20_RS26035 | 179051..179479 | + | 429 | WP_023345594.1 | nuclear transport factor 2 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA | 1..233683 | 233683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15082.55 Da Isoelectric Point: 7.8644
>T291631 WP_023345587.1 NZ_LR890625:c175344-174928 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLMLEDWVN
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLMLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|