Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 20483..21234 | Replicon | plasmid 2 |
| Accession | NZ_LR890625 | ||
| Organism | Klebsiella pneumoniae isolate INF242-sc-2280140 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A6P1V716 |
| Locus tag | JMX20_RS25345 | Protein ID | WP_048978473.1 |
| Coordinates | 20752..21234 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A6P1V8A4 |
| Locus tag | JMX20_RS25340 | Protein ID | WP_048978474.1 |
| Coordinates | 20483..20761 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX20_RS25325 | 17617..18075 | + | 459 | WP_173675456.1 | hypothetical protein | - |
| JMX20_RS25330 | 18318..18632 | - | 315 | WP_201530455.1 | hypothetical protein | - |
| JMX20_RS25335 | 19639..20175 | - | 537 | WP_048978475.1 | hypothetical protein | - |
| JMX20_RS25340 | 20483..20761 | + | 279 | WP_048978474.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX20_RS25345 | 20752..21234 | + | 483 | WP_048978473.1 | GNAT family N-acetyltransferase | Toxin |
| JMX20_RS25350 | 21272..21676 | + | 405 | WP_004210282.1 | DUF2251 domain-containing protein | - |
| JMX20_RS25355 | 22440..23912 | + | 1473 | WP_077268816.1 | conjugative transfer system coupling protein TraD | - |
| JMX20_RS25360 | 23905..24663 | + | 759 | WP_063445087.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| JMX20_RS25365 | 24748..25434 | - | 687 | WP_048330700.1 | hypothetical protein | - |
| JMX20_RS25370 | 25626..25973 | + | 348 | WP_048330699.1 | hypothetical protein | - |
| JMX20_RS25375 | 25973..26215 | + | 243 | WP_003029734.1 | TIGR03758 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA | 1..233683 | 233683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17763.69 Da Isoelectric Point: 9.4946
>T291629 WP_048978473.1 NZ_LR890625:20752-21234 [Klebsiella pneumoniae]
MGLRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGLRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P1V716 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P1V8A4 |