Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 181868..182394 | Replicon | plasmid 2 |
| Accession | NZ_LR890621 | ||
| Organism | Klebsiella pneumoniae isolate KSB2_1C-sc-2280352 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | JMX37_RS26785 | Protein ID | WP_000323025.1 |
| Coordinates | 181868..182155 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | J5W3H0 |
| Locus tag | JMX37_RS26790 | Protein ID | WP_004196370.1 |
| Coordinates | 182155..182394 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX37_RS26745 | 177183..177407 | - | 225 | WP_014343499.1 | hypothetical protein | - |
| JMX37_RS26750 | 177418..177630 | - | 213 | WP_019706020.1 | hypothetical protein | - |
| JMX37_RS26755 | 177691..178047 | - | 357 | WP_019706019.1 | hypothetical protein | - |
| JMX37_RS26760 | 178888..179205 | - | 318 | WP_015065519.1 | hypothetical protein | - |
| JMX37_RS26765 | 179220..179570 | - | 351 | WP_032425551.1 | hypothetical protein | - |
| JMX37_RS26770 | 179567..179839 | - | 273 | WP_032425552.1 | hypothetical protein | - |
| JMX37_RS26775 | 180537..180695 | - | 159 | WP_014343509.1 | type I toxin-antitoxin system Hok family toxin | - |
| JMX37_RS26780 | 180767..181801 | + | 1035 | Protein_193 | IS481 family transposase | - |
| JMX37_RS26785 | 181868..182155 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| JMX37_RS26790 | 182155..182394 | - | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| JMX37_RS26795 | 182645..183010 | + | 366 | WP_009651956.1 | hypothetical protein | - |
| JMX37_RS26800 | 183054..183791 | + | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
| JMX37_RS26805 | 183805..184494 | + | 690 | WP_004196322.1 | hypothetical protein | - |
| JMX37_RS26810 | 184525..185901 | - | 1377 | WP_004196363.1 | chromate efflux transporter | - |
| JMX37_RS26815 | 185858..186835 | - | 978 | WP_004196334.1 | chromate resistance protein | - |
| JMX37_RS26820 | 186865..187057 | + | 193 | Protein_201 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ | 1..230118 | 230118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T291616 WP_000323025.1 NZ_LR890621:c182155-181868 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|