Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 61657..62393 | Replicon | plasmid 2 |
| Accession | NZ_LR890621 | ||
| Organism | Klebsiella pneumoniae isolate KSB2_1C-sc-2280352 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | JMX37_RS26175 | Protein ID | WP_003026803.1 |
| Coordinates | 61911..62393 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMX37_RS26170 | Protein ID | WP_003026799.1 |
| Coordinates | 61657..61923 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX37_RS26130 | 57020..58558 | + | 1539 | WP_201559110.1 | IS66 family transposase | - |
| JMX37_RS26135 | 58848..59111 | + | 264 | WP_009310051.1 | hypothetical protein | - |
| JMX37_RS26140 | 59108..59674 | + | 567 | WP_009310052.1 | hypothetical protein | - |
| JMX37_RS26145 | 59705..60199 | + | 495 | WP_009310053.1 | hypothetical protein | - |
| JMX37_RS26150 | 60243..60611 | + | 369 | WP_009310054.1 | hypothetical protein | - |
| JMX37_RS26155 | 60642..60845 | + | 204 | WP_004098931.1 | hemolysin expression modulator Hha | - |
| JMX37_RS26160 | 60894..61151 | + | 258 | WP_004098928.1 | hypothetical protein | - |
| JMX37_RS26165 | 61227..61481 | + | 255 | WP_004118702.1 | hypothetical protein | - |
| JMX37_RS26170 | 61657..61923 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX37_RS26175 | 61911..62393 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| JMX37_RS26180 | 62594..63997 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| JMX37_RS26185 | 64026..64658 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| JMX37_RS26190 | 65182..66186 | - | 1005 | WP_000427620.1 | IS110-like element IS4321 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ | 1..230118 | 230118 | |
| - | inside | IScluster/Tn | - | - | 56223..73507 | 17284 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T291615 WP_003026803.1 NZ_LR890621:61911-62393 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |