Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 28717..29360 Replicon plasmid 2
Accession NZ_LR890621
Organism Klebsiella pneumoniae isolate KSB2_1C-sc-2280352

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag JMX37_RS25990 Protein ID WP_001044770.1
Coordinates 28944..29360 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag JMX37_RS25985 Protein ID WP_001261282.1
Coordinates 28717..28947 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX37_RS25955 23857..24876 + 1020 Protein_28 HlyD family secretion protein -
JMX37_RS25960 24944..25924 + 981 WP_000019450.1 IS5-like element ISKpn26 family transposase -
JMX37_RS25965 26246..27182 + 937 Protein_30 CAAX protease -
JMX37_RS25970 27373..27813 - 441 WP_047057603.1 hypothetical protein -
JMX37_RS25975 27832..28425 - 594 WP_009309909.1 hypothetical protein -
JMX37_RS25980 28524..28760 - 237 Protein_33 hypothetical protein -
JMX37_RS25985 28717..28947 + 231 WP_001261282.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMX37_RS25990 28944..29360 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
JMX37_RS25995 29434..30996 + 1563 WP_009309907.1 AAA family ATPase -
JMX37_RS26000 30981..32003 + 1023 WP_000361404.1 helicase UvrD -
JMX37_RS26005 32547..33455 + 909 WP_032425603.1 HNH endonuclease -
JMX37_RS26010 33641..33991 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ 1..230118 230118
- flank IS/Tn - - 24944..25924 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T291614 WP_001044770.1 NZ_LR890621:28944-29360 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT291614 WP_001261282.1 NZ_LR890621:28717-28947 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References