Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 21633..22276 Replicon plasmid 2
Accession NZ_LR890621
Organism Klebsiella pneumoniae isolate KSB2_1C-sc-2280352

Toxin (Protein)


Gene name vagD Uniprot ID A0A3Q8D6L7
Locus tag JMX37_RS25945 Protein ID WP_020804312.1
Coordinates 21860..22276 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag JMX37_RS25940 Protein ID WP_001261276.1
Coordinates 21633..21863 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX37_RS25900 17173..17286 + 114 WP_014343462.1 hypothetical protein -
JMX37_RS25905 17415..17672 + 258 WP_009310077.1 hypothetical protein -
JMX37_RS25910 17730..18509 - 780 WP_023287113.1 site-specific integrase -
JMX37_RS25915 18707..19723 - 1017 WP_009309921.1 hypothetical protein -
JMX37_RS25920 19757..20092 - 336 WP_009309920.1 hypothetical protein -
JMX37_RS25925 20142..20282 - 141 WP_162898808.1 hypothetical protein -
JMX37_RS25930 20511..20816 - 306 WP_004197633.1 type II toxin-antitoxin system toxin CcdB -
JMX37_RS25935 20818..21036 - 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA -
JMX37_RS25940 21633..21863 + 231 WP_001261276.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMX37_RS25945 21860..22276 + 417 WP_020804312.1 type II toxin-antitoxin system VapC family toxin Toxin
JMX37_RS25950 22317..23195 - 879 WP_009309916.1 restriction endonuclease -
JMX37_RS25955 23857..24876 + 1020 Protein_28 HlyD family secretion protein -
JMX37_RS25960 24944..25924 + 981 WP_000019450.1 IS5-like element ISKpn26 family transposase -
JMX37_RS25965 26246..27182 + 937 Protein_30 CAAX protease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ 1..230118 230118
- flank IS/Tn - - 16090..17070 980
- flank IS/Tn - - 24944..25924 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15154.59 Da        Isoelectric Point: 7.8637

>T291613 WP_020804312.1 NZ_LR890621:21860-22276 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPESVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT291613 WP_001261276.1 NZ_LR890621:21633-21863 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Q8D6L7

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References