Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 21633..22276 | Replicon | plasmid 2 |
| Accession | NZ_LR890621 | ||
| Organism | Klebsiella pneumoniae isolate KSB2_1C-sc-2280352 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A3Q8D6L7 |
| Locus tag | JMX37_RS25945 | Protein ID | WP_020804312.1 |
| Coordinates | 21860..22276 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | JMX37_RS25940 | Protein ID | WP_001261276.1 |
| Coordinates | 21633..21863 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX37_RS25900 | 17173..17286 | + | 114 | WP_014343462.1 | hypothetical protein | - |
| JMX37_RS25905 | 17415..17672 | + | 258 | WP_009310077.1 | hypothetical protein | - |
| JMX37_RS25910 | 17730..18509 | - | 780 | WP_023287113.1 | site-specific integrase | - |
| JMX37_RS25915 | 18707..19723 | - | 1017 | WP_009309921.1 | hypothetical protein | - |
| JMX37_RS25920 | 19757..20092 | - | 336 | WP_009309920.1 | hypothetical protein | - |
| JMX37_RS25925 | 20142..20282 | - | 141 | WP_162898808.1 | hypothetical protein | - |
| JMX37_RS25930 | 20511..20816 | - | 306 | WP_004197633.1 | type II toxin-antitoxin system toxin CcdB | - |
| JMX37_RS25935 | 20818..21036 | - | 219 | WP_006788213.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| JMX37_RS25940 | 21633..21863 | + | 231 | WP_001261276.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMX37_RS25945 | 21860..22276 | + | 417 | WP_020804312.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX37_RS25950 | 22317..23195 | - | 879 | WP_009309916.1 | restriction endonuclease | - |
| JMX37_RS25955 | 23857..24876 | + | 1020 | Protein_28 | HlyD family secretion protein | - |
| JMX37_RS25960 | 24944..25924 | + | 981 | WP_000019450.1 | IS5-like element ISKpn26 family transposase | - |
| JMX37_RS25965 | 26246..27182 | + | 937 | Protein_30 | CAAX protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ | 1..230118 | 230118 | |
| - | flank | IS/Tn | - | - | 16090..17070 | 980 | |
| - | flank | IS/Tn | - | - | 24944..25924 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15154.59 Da Isoelectric Point: 7.8637
>T291613 WP_020804312.1 NZ_LR890621:21860-22276 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPESVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPESVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q8D6L7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |