Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 44170..44813 | Replicon | plasmid 3 |
Accession | NZ_LR890618 | ||
Organism | Klebsiella pneumoniae isolate INF359-sc-2280194 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | JMX12_RS27640 | Protein ID | WP_048335684.1 |
Coordinates | 44170..44586 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | JMX12_RS27645 | Protein ID | WP_001261276.1 |
Coordinates | 44583..44813 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX12_RS27625 | 39665..40359 | + | 695 | WP_096807533.1 | IS1 family transposase | - |
JMX12_RS27630 | 40414..43311 | - | 2898 | WP_023307208.1 | Tn3-like element Tn5403 family transposase | - |
JMX12_RS27635 | 43406..44011 | + | 606 | WP_000509966.1 | recombinase family protein | - |
JMX12_RS27640 | 44170..44586 | - | 417 | WP_048335684.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMX12_RS27645 | 44583..44813 | - | 231 | WP_001261276.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMX12_RS27650 | 45431..45730 | + | 300 | WP_052433691.1 | hypothetical protein | - |
JMX12_RS27655 | 45785..46471 | + | 687 | WP_114466423.1 | hypothetical protein | - |
JMX12_RS27660 | 46483..47265 | + | 783 | WP_020277927.1 | site-specific integrase | - |
JMX12_RS27665 | 47800..48555 | + | 756 | WP_001568031.1 | replication initiation protein RepE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..75695 | 75695 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15079.57 Da Isoelectric Point: 7.8644
>T291593 WP_048335684.1 NZ_LR890618:c44586-44170 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|