Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4202945..4203651 | Replicon | chromosome |
| Accession | NZ_LR890616 | ||
| Organism | Klebsiella pneumoniae isolate INF359-sc-2280194 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | JMX12_RS20610 | Protein ID | WP_024622903.1 |
| Coordinates | 4203283..4203651 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A485WAM6 |
| Locus tag | JMX12_RS20605 | Protein ID | WP_023302278.1 |
| Coordinates | 4202945..4203262 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX12_RS20560 | 4198086..4198910 | + | 825 | WP_023302271.1 | DUF945 domain-containing protein | - |
| JMX12_RS20565 | 4199119..4199829 | + | 711 | WP_023302272.1 | DeoR family transcriptional regulator | - |
| JMX12_RS20570 | 4199855..4200391 | + | 537 | WP_023302273.1 | DUF4339 domain-containing protein | - |
| JMX12_RS20575 | 4200433..4200870 | + | 438 | WP_023301392.1 | hypothetical protein | - |
| JMX12_RS20580 | 4200937..4201347 | + | 411 | WP_023302274.1 | hypothetical protein | - |
| JMX12_RS20585 | 4201425..4201661 | + | 237 | WP_032410024.1 | DUF905 domain-containing protein | - |
| JMX12_RS20590 | 4201748..4202206 | + | 459 | WP_023302275.1 | antirestriction protein | - |
| JMX12_RS20595 | 4202215..4202697 | + | 483 | WP_023302276.1 | RadC family protein | - |
| JMX12_RS20600 | 4202706..4202927 | + | 222 | WP_023302277.1 | DUF987 domain-containing protein | - |
| JMX12_RS20605 | 4202945..4203262 | + | 318 | WP_023302278.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JMX12_RS20610 | 4203283..4203651 | + | 369 | WP_024622903.1 | TA system toxin CbtA family protein | Toxin |
| JMX12_RS20615 | 4203648..4203989 | + | 342 | WP_024622904.1 | hypothetical protein | - |
| JMX12_RS20620 | 4204112..4206757 | - | 2646 | WP_024622905.1 | LuxR family transcriptional regulator | - |
| JMX12_RS20625 | 4207131..4208090 | + | 960 | WP_023302280.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13651.82 Da Isoelectric Point: 7.2897
>T291587 WP_024622903.1 NZ_LR890616:4203283-4203651 [Klebsiella pneumoniae]
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|