Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 17674..18311 Replicon plasmid 5
Accession NZ_LR890610
Organism Escherichia coli isolate MINF_8D-sc-2280460

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag JMW69_RS25300 Protein ID WP_024250608.1
Coordinates 17901..18311 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag JMW69_RS25295 Protein ID WP_024250607.1
Coordinates 17674..17904 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW69_RS25260 12723..13025 + 303 Protein_13 hypothetical protein -
JMW69_RS25265 13205..14071 - 867 WP_004118283.1 replication initiation protein -
JMW69_RS25270 14606..14710 + 105 WP_032409716.1 hypothetical protein -
JMW69_RS25275 14839..15096 + 258 WP_000764642.1 hypothetical protein -
JMW69_RS25280 15154..15930 - 777 WP_000015958.1 site-specific integrase -
JMW69_RS25285 15927..16670 - 744 WP_000129823.1 hypothetical protein -
JMW69_RS25290 16721..17071 - 351 WP_000493378.1 hypothetical protein -
JMW69_RS25295 17674..17904 + 231 WP_024250607.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW69_RS25300 17901..18311 + 411 WP_024250608.1 PIN domain-containing protein Toxin
JMW69_RS25305 18529..19503 + 975 Protein_22 AAA family ATPase -
JMW69_RS25310 19536..20141 - 606 WP_000509966.1 recombinase family protein -
JMW69_RS25315 20236..20400 + 165 Protein_24 DUF4158 domain-containing protein -
JMW69_RS25320 20464..21168 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
JMW69_RS25325 21249..22826 + 1578 WP_001323889.1 PAS domain-containing methyl-accepting chemotaxis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - wbtL 1..36700 36700


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-127)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14473.53 Da        Isoelectric Point: 4.5141

>T291577 WP_024250608.1 NZ_LR890610:17901-18311 [Escherichia coli]
VNRTYMLDTRLCAYIMREQPEAVLTRLEQAVLRGDRIVISAVTWAELSQAARASGPATQALADAFCASLDAVLAWDRAAV
DATTVIKAALAADGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPDLVLEDWVK

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8682.92 Da        Isoelectric Point: 7.9973

>AT291577 WP_024250607.1 NZ_LR890610:17674-17904 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGNCIILRPVRPSWRSFALMGKAAPDFMAERETVFSDQGRGEQ

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References