Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
| Location | 30785..31583 | Replicon | plasmid 3 |
| Accession | NZ_LR890608 | ||
| Organism | Escherichia coli isolate MINF_8D-sc-2280460 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | JMW69_RS24200 | Protein ID | WP_023908317.1 |
| Coordinates | 31062..31583 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
| Locus tag | JMW69_RS24195 | Protein ID | WP_001351987.1 |
| Coordinates | 30785..31054 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW69_RS24170 | 25906..27246 | - | 1341 | WP_000137333.1 | AAA family ATPase | - |
| JMW69_RS24175 | 27290..28030 | - | 741 | WP_001717320.1 | hypothetical protein | - |
| JMW69_RS24180 | 28320..29378 | + | 1059 | WP_113519370.1 | hypothetical protein | - |
| JMW69_RS24185 | 29439..29792 | - | 354 | WP_160378290.1 | hypothetical protein | - |
| JMW69_RS24190 | 29798..30466 | - | 669 | WP_000161228.1 | AAA family ATPase | - |
| JMW69_RS24195 | 30785..31054 | + | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
| JMW69_RS24200 | 31062..31583 | + | 522 | WP_023908317.1 | GNAT family N-acetyltransferase | Toxin |
| JMW69_RS24205 | 31751..32002 | - | 252 | WP_001404395.1 | hypothetical protein | - |
| JMW69_RS24210 | 32004..32696 | - | 693 | WP_000856757.1 | hypothetical protein | - |
| JMW69_RS24215 | 32710..33033 | - | 324 | WP_001717323.1 | hypothetical protein | - |
| JMW69_RS24220 | 33356..33964 | - | 609 | WP_031323050.1 | hypothetical protein | - |
| JMW69_RS24225 | 33964..34218 | - | 255 | WP_000120169.1 | hypothetical protein | - |
| JMW69_RS24230 | 34381..34908 | - | 528 | WP_023908314.1 | tail fiber assembly protein | - |
| JMW69_RS24235 | 34911..35825 | - | 915 | WP_113519376.1 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-15 | - | 1..115278 | 115278 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19497.36 Da Isoelectric Point: 8.9815
>T291575 WP_023908317.1 NZ_LR890608:31062-31583 [Escherichia coli]
VDNIKIEIFSGEKHYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEGRPKVLGYYTLSGSCFEKESLPSRSQQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLDFIQLVGNNERSL
FYPTKSIEKLFEE
VDNIKIEIFSGEKHYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEGRPKVLGYYTLSGSCFEKESLPSRSQQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLDFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|