Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 106829..107354 | Replicon | plasmid 2 |
| Accession | NZ_LR890607 | ||
| Organism | Escherichia coli isolate MINF_8D-sc-2280460 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | JMW69_RS23910 | Protein ID | WP_001159868.1 |
| Coordinates | 106829..107134 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | JMW69_RS23915 | Protein ID | WP_000813634.1 |
| Coordinates | 107136..107354 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW69_RS23895 | 102793..103959 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| JMW69_RS23900 | 104547..105302 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| JMW69_RS23905 | 106022..106828 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| JMW69_RS23910 | 106829..107134 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| JMW69_RS23915 | 107136..107354 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| JMW69_RS23920 | 108062..109057 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| JMW69_RS23925 | 109061..109993 | + | 933 | WP_000991832.1 | hypothetical protein | - |
| JMW69_RS23930 | 110130..110827 | - | 698 | Protein_130 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / erm(B) | senB | 1..126618 | 126618 | |
| - | flank | IS/Tn | - | - | 110130..110633 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T291573 WP_001159868.1 NZ_LR890607:c107134-106829 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|