Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 22733..23258 Replicon plasmid 2
Accession NZ_LR890601
Organism Klebsiella pneumoniae isolate INF122-sc-2279936

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag JMW81_RS26205 Protein ID WP_013023785.1
Coordinates 22953..23258 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag JMW81_RS26200 Protein ID WP_001568025.1
Coordinates 22733..22951 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW81_RS26175 18859..19881 - 1023 WP_000361404.1 helicase UvrD -
JMW81_RS26180 19866..21428 - 1563 WP_009309907.1 AAA family ATPase -
JMW81_RS26185 21502..21918 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
JMW81_RS26190 21915..22145 - 231 WP_001261282.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMW81_RS26195 22102..22563 + 462 WP_160866775.1 hypothetical protein -
JMW81_RS26200 22733..22951 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JMW81_RS26205 22953..23258 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
JMW81_RS26210 23445..24449 + 1005 WP_029497484.1 hypothetical protein -
JMW81_RS26215 24647..25426 + 780 WP_029497485.1 site-specific integrase -
JMW81_RS26220 25484..25741 - 258 WP_000764642.1 hypothetical protein -
JMW81_RS26225 25870..25983 - 114 WP_012540012.1 hypothetical protein -
JMW81_RS26230 26617..27372 + 756 WP_012539983.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..72169 72169


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T291510 WP_013023785.1 NZ_LR890601:22953-23258 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT291510 WP_001568025.1 NZ_LR890601:22733-22951 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References