Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53667..54403 Replicon plasmid 2
Accession NZ_LR890596
Organism Klebsiella pneumoniae isolate INF223-sc-2280103

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag JMW78_RS25665 Protein ID WP_003026803.1
Coordinates 53921..54403 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag JMW78_RS25660 Protein ID WP_003026799.1
Coordinates 53667..53933 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW78_RS25615 49729..50091 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
JMW78_RS25620 50141..50491 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
JMW78_RS25625 50849..51118 + 270 WP_004152102.1 hypothetical protein -
JMW78_RS25630 51106..51681 + 576 WP_004152103.1 hypothetical protein -
JMW78_RS25635 51712..52206 + 495 WP_004152104.1 DNA-binding protein -
JMW78_RS25640 52250..52618 + 369 WP_004152105.1 hypothetical protein -
JMW78_RS25645 52652..52855 + 204 WP_004152106.1 hemolysin expression modulator Hha -
JMW78_RS25650 52904..53161 + 258 WP_004152107.1 hypothetical protein -
JMW78_RS25655 53237..53491 + 255 WP_004152108.1 hypothetical protein -
JMW78_RS25660 53667..53933 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
JMW78_RS25665 53921..54403 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
JMW78_RS25670 54604..56007 + 1404 WP_004883460.1 ISNCY-like element ISKpn21 family transposase -
JMW78_RS25675 56036..56668 - 633 WP_004883463.1 hypothetical protein -
JMW78_RS25680 56887..58290 + 1404 WP_004883460.1 ISNCY-like element ISKpn21 family transposase -
JMW78_RS25685 58319..58951 - 633 WP_004883463.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / qacE / sul1 / tet(D) / blaSHV-1 - 1..244314 244314


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T291493 WP_003026803.1 NZ_LR890596:53921-54403 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT291493 WP_003026799.1 NZ_LR890596:53667-53933 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References