Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5193122..5193747 | Replicon | chromosome |
| Accession | NZ_LR890595 | ||
| Organism | Klebsiella pneumoniae isolate INF223-sc-2280103 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | JMW78_RS25025 | Protein ID | WP_062921072.1 |
| Coordinates | 5193122..5193505 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | JMW78_RS25030 | Protein ID | WP_004150355.1 |
| Coordinates | 5193505..5193747 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW78_RS25010 | 5190488..5191390 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| JMW78_RS25015 | 5191387..5192022 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| JMW78_RS25020 | 5192019..5192948 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| JMW78_RS25025 | 5193122..5193505 | - | 384 | WP_062921072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMW78_RS25030 | 5193505..5193747 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| JMW78_RS25035 | 5193952..5194869 | + | 918 | WP_065519842.1 | alpha/beta hydrolase | - |
| JMW78_RS25040 | 5194883..5195824 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| JMW78_RS25045 | 5195869..5196306 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| JMW78_RS25050 | 5196303..5197163 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| JMW78_RS25055 | 5197157..5197756 | - | 600 | WP_114444895.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T291492 WP_062921072.1 NZ_LR890595:c5193505-5193122 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDALILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDALILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|