Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3957271..3957890 Replicon chromosome
Accession NZ_LR890595
Organism Klebsiella pneumoniae isolate INF223-sc-2280103

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMW78_RS19190 Protein ID WP_002892050.1
Coordinates 3957672..3957890 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMW78_RS19185 Protein ID WP_002892066.1
Coordinates 3957271..3957645 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW78_RS19175 3952423..3953616 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMW78_RS19180 3953639..3956785 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMW78_RS19185 3957271..3957645 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMW78_RS19190 3957672..3957890 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMW78_RS19195 3958049..3958615 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMW78_RS19200 3958587..3958727 - 141 WP_004147370.1 hypothetical protein -
JMW78_RS19205 3958748..3959218 + 471 WP_002892026.1 YlaC family protein -
JMW78_RS19210 3959193..3960644 - 1452 WP_117029258.1 PLP-dependent aminotransferase family protein -
JMW78_RS19215 3960745..3961443 + 699 WP_002892021.1 GNAT family N-acetyltransferase -
JMW78_RS19220 3961440..3961580 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMW78_RS19225 3961580..3961843 - 264 WP_048264404.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291489 WP_002892050.1 NZ_LR890595:3957672-3957890 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291489 WP_002892066.1 NZ_LR890595:3957271-3957645 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References