Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 13704..14347 | Replicon | plasmid 2 |
Accession | NZ_LR890584 | ||
Organism | Klebsiella pneumoniae isolate INF145-sc-2279981 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A3A3ZBE4 |
Locus tag | JMW91_RS25500 | Protein ID | WP_007374381.1 |
Coordinates | 13931..14347 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | G8LQB1 |
Locus tag | JMW91_RS25495 | Protein ID | WP_007853351.1 |
Coordinates | 13704..13934 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW91_RS25475 | 9350..9607 | - | 258 | WP_023292103.1 | hypothetical protein | - |
JMW91_RS25480 | 10211..11665 | + | 1455 | WP_074180203.1 | EAL domain-containing protein | - |
JMW91_RS25485 | 12199..12729 | - | 531 | Protein_10 | hypothetical protein | - |
JMW91_RS25490 | 12780..13130 | - | 351 | WP_023292071.1 | hypothetical protein | - |
JMW91_RS25495 | 13704..13934 | + | 231 | WP_007853351.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMW91_RS25500 | 13931..14347 | + | 417 | WP_007374381.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW91_RS25505 | 14420..15982 | + | 1563 | WP_201510810.1 | AAA family ATPase | - |
JMW91_RS25510 | 15967..16989 | + | 1023 | WP_201510811.1 | DNA helicase UvrD | - |
JMW91_RS25515 | 17198..17755 | + | 558 | WP_007374384.1 | OsmC family protein | - |
JMW91_RS25520 | 17939..18508 | + | 570 | WP_042936984.1 | TetR/AcrR family transcriptional regulator | - |
JMW91_RS25525 | 18525..18863 | + | 339 | WP_007374386.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..126908 | 126908 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15105.57 Da Isoelectric Point: 7.8882
>T291479 WP_007374381.1 NZ_LR890584:13931-14347 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYAEMRFGATGPKAAPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYAEMRFGATGPKAAPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A3ZBE4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A3Z894 |