Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4716791..4717307 | Replicon | chromosome |
Accession | NZ_LR890583 | ||
Organism | Klebsiella pneumoniae isolate INF145-sc-2279981 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A483NZA3 |
Locus tag | JMW91_RS22810 | Protein ID | WP_004894697.1 |
Coordinates | 4716791..4717075 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMW91_RS22815 | Protein ID | WP_002886901.1 |
Coordinates | 4717065..4717307 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW91_RS22785 | 4712186..4712494 | - | 309 | WP_004894688.1 | PTS sugar transporter subunit IIB | - |
JMW91_RS22790 | 4712579..4712752 | + | 174 | WP_002886906.1 | hypothetical protein | - |
JMW91_RS22795 | 4712755..4713498 | + | 744 | WP_004894691.1 | MurR/RpiR family transcriptional regulator | - |
JMW91_RS22800 | 4713856..4715994 | + | 2139 | WP_023325427.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMW91_RS22805 | 4716323..4716787 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMW91_RS22810 | 4716791..4717075 | - | 285 | WP_004894697.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW91_RS22815 | 4717065..4717307 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMW91_RS22820 | 4717385..4719295 | - | 1911 | WP_201510737.1 | BglG family transcription antiterminator | - |
JMW91_RS22825 | 4719318..4720472 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
JMW91_RS22830 | 4720539..4721279 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11174.05 Da Isoelectric Point: 10.3787
>T291477 WP_004894697.1 NZ_LR890583:c4717075-4716791 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483NZA3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |