Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4650320..4651023 | Replicon | chromosome |
Accession | NZ_LR890583 | ||
Organism | Klebsiella pneumoniae isolate INF145-sc-2279981 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | JMW91_RS22500 | Protein ID | WP_040196446.1 |
Coordinates | 4650320..4650661 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | JMW91_RS22505 | Protein ID | WP_040196448.1 |
Coordinates | 4650682..4651023 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW91_RS22475 | 4646898..4648025 | + | 1128 | WP_023325431.1 | PAAR domain-containing protein | - |
JMW91_RS22480 | 4648015..4648278 | + | 264 | WP_004192273.1 | hypothetical protein | - |
JMW91_RS22485 | 4648424..4648558 | + | 135 | Protein_4407 | transposase | - |
JMW91_RS22490 | 4648571..4648681 | - | 111 | Protein_4408 | DUF4102 domain-containing protein | - |
JMW91_RS22495 | 4649055..4650062 | - | 1008 | WP_004216518.1 | restriction endonuclease | - |
JMW91_RS22500 | 4650320..4650661 | - | 342 | WP_040196446.1 | TA system toxin CbtA family protein | Toxin |
JMW91_RS22505 | 4650682..4651023 | - | 342 | WP_040196448.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMW91_RS22510 | 4651034..4651576 | - | 543 | WP_004894621.1 | DNA repair protein RadC | - |
JMW91_RS22515 | 4651589..4652032 | - | 444 | WP_004894623.1 | antirestriction protein | - |
JMW91_RS22520 | 4652063..4652884 | - | 822 | WP_040196452.1 | DUF945 domain-containing protein | - |
JMW91_RS22525 | 4652983..4653213 | - | 231 | WP_014226751.1 | DUF905 domain-containing protein | - |
JMW91_RS22530 | 4653285..4653734 | - | 450 | WP_004215773.1 | hypothetical protein | - |
JMW91_RS22535 | 4653731..4654183 | - | 453 | WP_040196455.1 | hypothetical protein | - |
JMW91_RS22540 | 4654220..4654789 | - | 570 | WP_040196457.1 | hypothetical protein | - |
JMW91_RS22545 | 4654789..4655493 | - | 705 | WP_040196458.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4644106..4664762 | 20656 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12791.74 Da Isoelectric Point: 7.1648
>T291476 WP_040196446.1 NZ_LR890583:c4650661-4650320 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|