Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4005037..4005656 Replicon chromosome
Accession NZ_LR890583
Organism Klebsiella pneumoniae isolate INF145-sc-2279981

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMW91_RS19390 Protein ID WP_002892050.1
Coordinates 4005438..4005656 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMW91_RS19385 Protein ID WP_002892066.1
Coordinates 4005037..4005411 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW91_RS19375 4000189..4001382 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMW91_RS19380 4001405..4004551 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMW91_RS19385 4005037..4005411 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMW91_RS19390 4005438..4005656 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMW91_RS19395 4005815..4006381 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMW91_RS19400 4006353..4006493 - 141 WP_032409038.1 hypothetical protein -
JMW91_RS19405 4006514..4006984 + 471 WP_002892026.1 YlaC family protein -
JMW91_RS19410 4006959..4008410 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMW91_RS19415 4008511..4009209 + 699 WP_004893822.1 GNAT family N-acetyltransferase -
JMW91_RS19420 4009206..4009346 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMW91_RS19425 4009346..4009609 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291474 WP_002892050.1 NZ_LR890583:4005438-4005656 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291474 WP_002892066.1 NZ_LR890583:4005037-4005411 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References