Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 53536..54272 | Replicon | plasmid 2 |
Accession | NZ_LR890572 | ||
Organism | Klebsiella pneumoniae isolate INF327-sc-2280132 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | JMX40_RS25520 | Protein ID | WP_003026803.1 |
Coordinates | 53790..54272 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMX40_RS25515 | Protein ID | WP_003026799.1 |
Coordinates | 53536..53802 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX40_RS25470 | 49736..50098 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
JMX40_RS25475 | 50148..50498 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
JMX40_RS25480 | 50856..51104 | + | 249 | WP_019725036.1 | hypothetical protein | - |
JMX40_RS25485 | 51101..51673 | + | 573 | WP_015065504.1 | hypothetical protein | - |
JMX40_RS25490 | 51704..52198 | + | 495 | WP_009310053.1 | hypothetical protein | - |
JMX40_RS25495 | 52242..52610 | + | 369 | WP_015065502.1 | hypothetical protein | - |
JMX40_RS25500 | 52644..52847 | + | 204 | WP_019725040.1 | hemolysin expression modulator Hha | - |
JMX40_RS25505 | 52861..53091 | + | 231 | WP_019725034.1 | hypothetical protein | - |
JMX40_RS25510 | 53135..53329 | - | 195 | WP_019725033.1 | hypothetical protein | - |
JMX40_RS25515 | 53536..53802 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMX40_RS25520 | 53790..54272 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
JMX40_RS25525 | 54480..55826 | + | 1347 | WP_077253535.1 | ISNCY family transposase | - |
JMX40_RS25530 | 55875..56270 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
JMX40_RS25535 | 56418..57672 | - | 1255 | Protein_58 | IS3 family transposase | - |
JMX40_RS25540 | 57760..58722 | - | 963 | WP_004152113.1 | M48 family metalloprotease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 | - | 1..227807 | 227807 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T291462 WP_003026803.1 NZ_LR890572:53790-54272 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |