Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4570361..4571171 | Replicon | chromosome |
Accession | NZ_LR890571 | ||
Organism | Klebsiella pneumoniae isolate INF327-sc-2280132 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | JMX40_RS22170 | Protein ID | WP_040148415.1 |
Coordinates | 4570361..4570894 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | JMX40_RS22175 | Protein ID | WP_002887278.1 |
Coordinates | 4570905..4571171 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX40_RS22165 | 4569192..4570313 | + | 1122 | WP_016946712.1 | cupin domain-containing protein | - |
JMX40_RS22170 | 4570361..4570894 | - | 534 | WP_040148415.1 | GNAT family N-acetyltransferase | Toxin |
JMX40_RS22175 | 4570905..4571171 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
JMX40_RS22180 | 4571274..4572707 | - | 1434 | WP_040148413.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
JMX40_RS22185 | 4572697..4573380 | - | 684 | WP_020804437.1 | copper response regulator transcription factor CusR | - |
JMX40_RS22190 | 4573552..4574937 | + | 1386 | WP_040148411.1 | efflux transporter outer membrane subunit | - |
JMX40_RS22195 | 4574955..4575299 | + | 345 | WP_040148409.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19909.78 Da Isoelectric Point: 5.7068
>T291458 WP_040148415.1 NZ_LR890571:c4570894-4570361 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSRDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSRDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|