Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 53887..54623 | Replicon | plasmid 2 |
Accession | NZ_LR890570 | ||
Organism | Klebsiella pneumoniae isolate INF144-sc-2279979 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | JMW96_RS25810 | Protein ID | WP_003026803.1 |
Coordinates | 54141..54623 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMW96_RS25805 | Protein ID | WP_003026799.1 |
Coordinates | 53887..54153 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW96_RS25760 | 49949..50311 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
JMW96_RS25765 | 50361..50711 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
JMW96_RS25770 | 51069..51338 | + | 270 | WP_004152102.1 | hypothetical protein | - |
JMW96_RS25775 | 51326..51901 | + | 576 | WP_004152103.1 | hypothetical protein | - |
JMW96_RS25780 | 51932..52426 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
JMW96_RS25785 | 52470..52838 | + | 369 | WP_004152105.1 | hypothetical protein | - |
JMW96_RS25790 | 52872..53075 | + | 204 | WP_004152106.1 | hemolysin expression modulator Hha | - |
JMW96_RS25795 | 53124..53381 | + | 258 | WP_004152107.1 | hypothetical protein | - |
JMW96_RS25800 | 53457..53711 | + | 255 | WP_004152108.1 | hypothetical protein | - |
JMW96_RS25805 | 53887..54153 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMW96_RS25810 | 54141..54623 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
JMW96_RS25815 | 54782..56036 | - | 1255 | Protein_58 | IS3 family transposase | - |
JMW96_RS25820 | 56124..57086 | - | 963 | WP_004152113.1 | M48 family metalloprotease | - |
JMW96_RS25825 | 57073..57561 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
JMW96_RS25830 | 58059..58256 | - | 198 | WP_004152115.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..186641 | 186641 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T291447 WP_003026803.1 NZ_LR890570:54141-54623 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |