Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 141640..142376 Replicon plasmid 2
Accession NZ_LR890565
Organism Klebsiella pneumoniae isolate KSB2_9A-sc-2280332

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag JMW10_RS26075 Protein ID WP_003026803.1
Coordinates 141894..142376 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag JMW10_RS26070 Protein ID WP_003026799.1
Coordinates 141640..141906 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW10_RS26025 137840..138202 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
JMW10_RS26030 138252..138602 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
JMW10_RS26035 138960..139208 + 249 WP_019725036.1 hypothetical protein -
JMW10_RS26040 139205..139777 + 573 WP_015065504.1 hypothetical protein -
JMW10_RS26045 139808..140302 + 495 WP_009310053.1 hypothetical protein -
JMW10_RS26050 140346..140714 + 369 WP_015065502.1 hypothetical protein -
JMW10_RS26055 140748..140951 + 204 WP_019725040.1 hemolysin expression modulator Hha -
JMW10_RS26060 140965..141195 + 231 WP_019725034.1 hypothetical protein -
JMW10_RS26065 141239..141433 - 195 WP_019725033.1 hypothetical protein -
JMW10_RS26070 141640..141906 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
JMW10_RS26075 141894..142376 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
JMW10_RS26080 142584..143930 + 1347 WP_077253535.1 ISNCY family transposase -
JMW10_RS26085 143979..144374 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
JMW10_RS26090 144522..145776 - 1255 Protein_152 IS3 family transposase -
JMW10_RS26095 145864..146826 - 963 WP_004152113.1 M48 family metalloprotease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / qnrB1 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B - 1..228690 228690


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T291434 WP_003026803.1 NZ_LR890565:141894-142376 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT291434 WP_003026799.1 NZ_LR890565:141640-141906 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References