Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 150700..151301 Replicon plasmid 2
Accession NZ_LR890563
Organism Klebsiella pneumoniae isolate INF247-sc-2280148

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag JMW77_RS26310 Protein ID WP_001216034.1
Coordinates 150921..151301 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag JMW77_RS26305 Protein ID WP_001190712.1
Coordinates 150700..150921 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW77_RS26295 147681..148964 - 1284 WP_001617890.1 restriction endonuclease subunit S -
JMW77_RS26300 148961..150517 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
JMW77_RS26305 150700..150921 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW77_RS26310 150921..151301 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW77_RS26315 151306..151485 + 180 WP_001513661.1 hypothetical protein -
JMW77_RS26320 151513..151872 + 360 WP_001513660.1 hypothetical protein -
JMW77_RS26325 151796..152209 + 414 Protein_174 DDE-type integrase/transposase/recombinase -
JMW77_RS26330 152159..152476 - 318 WP_001513659.1 hypothetical protein -
JMW77_RS26335 152704..153720 - 1017 WP_012372828.1 IS5-like element IS5 family transposase -
JMW77_RS26340 153928..155331 + 1404 WP_001373486.1 S-methylmethionine permease -
JMW77_RS26345 155318..156250 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-14 / aadA5 / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) senB 1..159592 159592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T291419 WP_001216034.1 NZ_LR890563:150921-151301 [Klebsiella pneumoniae]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT291419 WP_001190712.1 NZ_LR890563:150700-150921 [Klebsiella pneumoniae]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References