Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1758578..1759168 | Replicon | chromosome |
Accession | NZ_LR890562 | ||
Organism | Klebsiella pneumoniae isolate INF247-sc-2280148 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | JMW77_RS08570 | Protein ID | WP_023341911.1 |
Coordinates | 1758836..1759168 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
Locus tag | JMW77_RS08565 | Protein ID | WP_000288812.1 |
Coordinates | 1758578..1758835 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW77_RS08540 | 1755178..1756527 | - | 1350 | WP_077254247.1 | DNA (cytosine-5-)-methyltransferase | - |
JMW77_RS08545 | 1756535..1756951 | - | 417 | WP_124047552.1 | hypothetical protein | - |
JMW77_RS08550 | 1757281..1757679 | + | 399 | WP_115657462.1 | ash family protein | - |
JMW77_RS08555 | 1757579..1758040 | + | 462 | WP_040210976.1 | hypothetical protein | - |
JMW77_RS08560 | 1758037..1758243 | + | 207 | WP_022615589.1 | helix-turn-helix domain-containing protein | - |
JMW77_RS08565 | 1758578..1758835 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
JMW77_RS08570 | 1758836..1759168 | + | 333 | WP_023341911.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
JMW77_RS08580 | 1759490..1760926 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
JMW77_RS08590 | 1761292..1762746 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
JMW77_RS08595 | 1762876..1763121 | - | 246 | WP_048337159.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11927.87 Da Isoelectric Point: 10.4722
>T291402 WP_023341911.1 NZ_LR890562:1758836-1759168 [Klebsiella pneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|