Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 815793..816450 | Replicon | chromosome |
| Accession | NZ_LR890562 | ||
| Organism | Klebsiella pneumoniae isolate INF247-sc-2280148 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | JMW77_RS04160 | Protein ID | WP_002916310.1 |
| Coordinates | 816040..816450 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | JMW77_RS04155 | Protein ID | WP_002916312.1 |
| Coordinates | 815793..816059 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW77_RS04130 | 811001..812434 | - | 1434 | WP_064164017.1 | 6-phospho-beta-glucosidase | - |
| JMW77_RS04135 | 812553..813281 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| JMW77_RS04140 | 813331..813642 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| JMW77_RS04145 | 813806..814465 | + | 660 | WP_004174454.1 | hemolysin III family protein | - |
| JMW77_RS04150 | 814564..815547 | - | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
| JMW77_RS04155 | 815793..816059 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| JMW77_RS04160 | 816040..816450 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| JMW77_RS04165 | 816457..816978 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| JMW77_RS04170 | 817079..817975 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| JMW77_RS04175 | 817998..818711 | + | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| JMW77_RS04180 | 818717..820450 | + | 1734 | WP_201527030.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T291401 WP_002916310.1 NZ_LR890562:816040-816450 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |