Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2607315..2607934 Replicon chromosome
Accession NZ_LR890556
Organism Klebsiella pneumoniae isolate INF302-sc-2280090

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMW84_RS12680 Protein ID WP_002892050.1
Coordinates 2607716..2607934 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMW84_RS12675 Protein ID WP_002892066.1
Coordinates 2607315..2607689 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW84_RS12665 2602467..2603660 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMW84_RS12670 2603683..2606829 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMW84_RS12675 2607315..2607689 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMW84_RS12680 2607716..2607934 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMW84_RS12685 2608093..2608659 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMW84_RS12690 2608631..2608771 - 141 WP_004147370.1 hypothetical protein -
JMW84_RS12695 2608792..2609262 + 471 WP_002892026.1 YlaC family protein -
JMW84_RS12700 2609237..2610688 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMW84_RS12705 2610789..2611487 + 699 WP_004177238.1 GNAT family N-acetyltransferase -
JMW84_RS12710 2611484..2611624 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMW84_RS12715 2611624..2611887 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291390 WP_002892050.1 NZ_LR890556:2607716-2607934 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291390 WP_002892066.1 NZ_LR890556:2607315-2607689 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References