Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 199575..200314 | Replicon | chromosome |
Accession | NZ_LR890554 | ||
Organism | Klebsiella pneumoniae isolate INF182-sc-2280049 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | JMW27_RS00975 | Protein ID | WP_021312536.1 |
Coordinates | 199829..200314 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMW27_RS00970 | Protein ID | WP_003026799.1 |
Coordinates | 199575..199841 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW27_RS00955 | 195078..197147 | + | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
JMW27_RS00960 | 197444..198813 | + | 1370 | WP_087830479.1 | IS3 family transposase | - |
JMW27_RS00965 | 199014..199442 | + | 429 | WP_004901287.1 | GFA family protein | - |
JMW27_RS00970 | 199575..199841 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMW27_RS00975 | 199829..200314 | + | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
JMW27_RS00980 | 200658..200810 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
JMW27_RS00985 | 201112..202731 | + | 1620 | WP_201519136.1 | ATP-binding cassette domain-containing protein | - |
JMW27_RS00990 | 202830..203042 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
JMW27_RS00995 | 203295..203585 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
JMW27_RS01000 | 203831..205186 | - | 1356 | WP_032415797.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 198088..198813 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T291370 WP_021312536.1 NZ_LR890554:199829-200314 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|