Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 80546..81189 Replicon plasmid 4
Accession NZ_LR890550
Organism Klebsiella pneumoniae isolate INF142-sc-2279977

Toxin (Protein)


Gene name vagD Uniprot ID R4IT02
Locus tag JMX11_RS28285 Protein ID WP_016338372.1
Coordinates 80773..81189 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID R4IT22
Locus tag JMX11_RS28280 Protein ID WP_016338373.1
Coordinates 80546..80776 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX11_RS28250 76143..77009 - 867 WP_004118283.1 replication initiation protein -
JMX11_RS28255 77544..77648 + 105 WP_032409716.1 hypothetical protein -
JMX11_RS28260 77777..78034 + 258 WP_000764642.1 hypothetical protein -
JMX11_RS28265 78092..78868 - 777 WP_000015958.1 site-specific integrase -
JMX11_RS28270 78865..79608 - 744 WP_000129823.1 hypothetical protein -
JMX11_RS28275 79659..80009 - 351 WP_000493378.1 hypothetical protein -
JMX11_RS28280 80546..80776 + 231 WP_016338373.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMX11_RS28285 80773..81189 + 417 WP_016338372.1 type II toxin-antitoxin system VapC family toxin Toxin
JMX11_RS28290 81230..82107 - 878 Protein_99 restriction endonuclease -
JMX11_RS28295 82766..84043 + 1278 WP_016338369.1 HlyD family secretion protein -
JMX11_RS28300 84033..86141 + 2109 WP_016338368.1 peptidase domain-containing ABC transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / qnrB1 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..89345 89345


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15060.57 Da        Isoelectric Point: 9.2738

>T291369 WP_016338372.1 NZ_LR890550:80773-81189 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8751.77 Da        Isoelectric Point: 4.3533

>AT291369 WP_016338373.1 NZ_LR890550:80546-80776 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWSSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R4IT02

Antitoxin

Source ID Structure
AlphaFold DB A0A5Q9LN61

References