Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 80546..81189 | Replicon | plasmid 4 |
| Accession | NZ_LR890550 | ||
| Organism | Klebsiella pneumoniae isolate INF142-sc-2279977 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | R4IT02 |
| Locus tag | JMX11_RS28285 | Protein ID | WP_016338372.1 |
| Coordinates | 80773..81189 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | R4IT22 |
| Locus tag | JMX11_RS28280 | Protein ID | WP_016338373.1 |
| Coordinates | 80546..80776 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX11_RS28250 | 76143..77009 | - | 867 | WP_004118283.1 | replication initiation protein | - |
| JMX11_RS28255 | 77544..77648 | + | 105 | WP_032409716.1 | hypothetical protein | - |
| JMX11_RS28260 | 77777..78034 | + | 258 | WP_000764642.1 | hypothetical protein | - |
| JMX11_RS28265 | 78092..78868 | - | 777 | WP_000015958.1 | site-specific integrase | - |
| JMX11_RS28270 | 78865..79608 | - | 744 | WP_000129823.1 | hypothetical protein | - |
| JMX11_RS28275 | 79659..80009 | - | 351 | WP_000493378.1 | hypothetical protein | - |
| JMX11_RS28280 | 80546..80776 | + | 231 | WP_016338373.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMX11_RS28285 | 80773..81189 | + | 417 | WP_016338372.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX11_RS28290 | 81230..82107 | - | 878 | Protein_99 | restriction endonuclease | - |
| JMX11_RS28295 | 82766..84043 | + | 1278 | WP_016338369.1 | HlyD family secretion protein | - |
| JMX11_RS28300 | 84033..86141 | + | 2109 | WP_016338368.1 | peptidase domain-containing ABC transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / qnrB1 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..89345 | 89345 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15060.57 Da Isoelectric Point: 9.2738
>T291369 WP_016338372.1 NZ_LR890550:80773-81189 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R4IT02 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q9LN61 |