Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4014768..4015387 | Replicon | chromosome |
Accession | NZ_LR890547 | ||
Organism | Klebsiella pneumoniae isolate INF142-sc-2279977 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | JMX11_RS19665 | Protein ID | WP_002892050.1 |
Coordinates | 4015169..4015387 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | JMX11_RS19660 | Protein ID | WP_099595242.1 |
Coordinates | 4014768..4015142 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX11_RS19650 | 4009920..4011113 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
JMX11_RS19655 | 4011136..4014282 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
JMX11_RS19660 | 4014768..4015142 | + | 375 | WP_099595242.1 | Hha toxicity modulator TomB | Antitoxin |
JMX11_RS19665 | 4015169..4015387 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
JMX11_RS19670 | 4015546..4016112 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
JMX11_RS19675 | 4016084..4016224 | - | 141 | WP_004147370.1 | hypothetical protein | - |
JMX11_RS19680 | 4016245..4016715 | + | 471 | WP_002892026.1 | YlaC family protein | - |
JMX11_RS19685 | 4016690..4018141 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
JMX11_RS19690 | 4018242..4018940 | + | 699 | WP_002892021.1 | GNAT family N-acetyltransferase | - |
JMX11_RS19695 | 4018937..4019077 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
JMX11_RS19700 | 4019077..4019340 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T291362 WP_002892050.1 NZ_LR890547:4015169-4015387 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14402.08 Da Isoelectric Point: 4.8989
>AT291362 WP_099595242.1 NZ_LR890547:4014768-4015142 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFAFNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFAFNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|