Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 18107..18632 | Replicon | plasmid 4 |
Accession | NZ_LR890545 | ||
Organism | Klebsiella pneumoniae isolate INF319-sc-2280116 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A9E1GGX2 |
Locus tag | JMX54_RS28260 | Protein ID | WP_016946795.1 |
Coordinates | 18327..18632 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A9E1GDP8 |
Locus tag | JMX54_RS28255 | Protein ID | WP_004197642.1 |
Coordinates | 18107..18325 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX54_RS28235 | 13877..14185 | + | 309 | WP_017896554.1 | hypothetical protein | - |
JMX54_RS28240 | 15410..15901 | - | 492 | WP_032249453.1 | hypothetical protein | - |
JMX54_RS28245 | 16035..17267 | - | 1233 | WP_032249456.1 | hypothetical protein | - |
JMX54_RS28250 | 17264..17512 | - | 249 | WP_004200907.1 | hypothetical protein | - |
JMX54_RS28255 | 18107..18325 | + | 219 | WP_004197642.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
JMX54_RS28260 | 18327..18632 | + | 306 | WP_016946795.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
JMX54_RS28265 | 18790..19473 | + | 684 | WP_023280892.1 | hypothetical protein | - |
JMX54_RS28270 | 19476..20252 | + | 777 | WP_160458681.1 | site-specific integrase | - |
JMX54_RS28275 | 20310..20567 | - | 258 | WP_000764642.1 | hypothetical protein | - |
JMX54_RS28280 | 20696..20800 | - | 105 | WP_032409716.1 | hypothetical protein | - |
JMX54_RS28285 | 21335..22201 | + | 867 | WP_004118283.1 | replication initiation protein | - |
JMX54_RS28290 | 22558..22827 | - | 270 | WP_000339857.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | aph(6)-Id / aph(3'')-Ib | mrkC / mrkD / mrkF / mrkJ / mrkA / mrkB | 1..73736 | 73736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11548.22 Da Isoelectric Point: 5.6831
>T291352 WP_016946795.1 NZ_LR890545:18327-18632 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDDSYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDDSYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|