Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 11373..12109 | Replicon | plasmid 4 |
Accession | NZ_LR890545 | ||
Organism | Klebsiella pneumoniae isolate INF319-sc-2280116 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | JMX54_RS28215 | Protein ID | WP_003026803.1 |
Coordinates | 11373..11855 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMX54_RS28220 | Protein ID | WP_003026799.1 |
Coordinates | 11843..12109 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX54_RS28195 | 7333..8358 | - | 1026 | WP_001101446.1 | IS110 family transposase | - |
JMX54_RS28200 | 8526..8723 | + | 198 | Protein_8 | IS3 family transposase | - |
JMX54_RS28205 | 8951..9655 | - | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
JMX54_RS28210 | 9815..11161 | - | 1347 | WP_077251107.1 | ISNCY family transposase | - |
JMX54_RS28215 | 11373..11855 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
JMX54_RS28220 | 11843..12109 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMX54_RS28225 | 12354..12788 | - | 435 | WP_001567367.1 | cell envelope integrity protein TolA | - |
JMX54_RS28230 | 12835..13383 | - | 549 | WP_001567366.1 | thioredoxin fold domain-containing protein | - |
JMX54_RS28235 | 13877..14185 | + | 309 | WP_017896554.1 | hypothetical protein | - |
JMX54_RS28240 | 15410..15901 | - | 492 | WP_032249453.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | aph(6)-Id / aph(3'')-Ib | mrkC / mrkD / mrkF / mrkJ / mrkA / mrkB | 1..73736 | 73736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T291351 WP_003026803.1 NZ_LR890545:c11855-11373 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |