Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 246967..247489 | Replicon | plasmid 2 |
Accession | NZ_LR890543 | ||
Organism | Klebsiella pneumoniae isolate INF319-sc-2280116 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
Locus tag | JMX54_RS27460 | Protein ID | WP_004181778.1 |
Coordinates | 246967..247251 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
Locus tag | JMX54_RS27465 | Protein ID | WP_004181777.1 |
Coordinates | 247241..247489 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX54_RS27430 | 242168..243263 | + | 1096 | Protein_241 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
JMX54_RS27435 | 243362..244549 | - | 1188 | WP_040209642.1 | transposase | - |
JMX54_RS27440 | 244585..245013 | + | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
JMX54_RS27445 | 245092..245316 | + | 225 | Protein_244 | transposase | - |
JMX54_RS27450 | 245587..246813 | - | 1227 | WP_040209639.1 | transposase | - |
JMX54_RS27455 | 246849..246950 | + | 102 | Protein_246 | IS200/IS605 family transposase | - |
JMX54_RS27460 | 246967..247251 | - | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX54_RS27465 | 247241..247489 | - | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JMX54_RS27470 | 247780..249579 | + | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
JMX54_RS27475 | 249913..250899 | + | 987 | WP_025368599.1 | hypothetical protein | - |
JMX54_RS27480 | 251044..251397 | + | 354 | WP_004181774.1 | hypothetical protein | - |
JMX54_RS27485 | 251459..252280 | + | 822 | WP_004181772.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..268509 | 268509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T291350 WP_004181778.1 NZ_LR890543:c247251-246967 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0S6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0U8 |