Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 82523..83049 | Replicon | plasmid 2 |
Accession | NZ_LR890543 | ||
Organism | Klebsiella pneumoniae isolate INF319-sc-2280116 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | JMX54_RS26615 | Protein ID | WP_000323025.1 |
Coordinates | 82523..82810 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J5W3H0 |
Locus tag | JMX54_RS26620 | Protein ID | WP_004196370.1 |
Coordinates | 82810..83049 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX54_RS26585 | 77566..77799 | - | 234 | WP_004196327.1 | hypothetical protein | - |
JMX54_RS26590 | 77878..78225 | - | 348 | WP_004196344.1 | hypothetical protein | - |
JMX54_RS26595 | 78381..79448 | - | 1068 | WP_004181903.1 | hypothetical protein | - |
JMX54_RS26600 | 80138..80515 | + | 378 | WP_004196351.1 | hypothetical protein | - |
JMX54_RS26605 | 80713..81687 | - | 975 | WP_004196336.1 | hypothetical protein | - |
JMX54_RS26610 | 82293..82451 | - | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
JMX54_RS26615 | 82523..82810 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
JMX54_RS26620 | 82810..83049 | - | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
JMX54_RS26625 | 83300..83665 | + | 366 | WP_009651956.1 | hypothetical protein | - |
JMX54_RS26630 | 83709..84446 | + | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
JMX54_RS26635 | 84460..85149 | + | 690 | WP_004196322.1 | hypothetical protein | - |
JMX54_RS26640 | 85180..86556 | - | 1377 | WP_004196363.1 | chromate efflux transporter | - |
JMX54_RS26645 | 86513..87490 | - | 978 | WP_004196334.1 | chromate resistance protein | - |
JMX54_RS26650 | 87520..87712 | + | 193 | Protein_85 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..268509 | 268509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T291348 WP_000323025.1 NZ_LR890543:c82810-82523 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|