Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4697421..4698231 | Replicon | chromosome |
Accession | NZ_LR890542 | ||
Organism | Klebsiella pneumoniae isolate INF319-sc-2280116 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A7Z7SK09 |
Locus tag | JMX54_RS23040 | Protein ID | WP_040190358.1 |
Coordinates | 4697421..4697930 (-) | Length | 170 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | JMX54_RS23045 | Protein ID | WP_002887278.1 |
Coordinates | 4697965..4698231 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX54_RS23035 | 4696252..4697373 | + | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
JMX54_RS23040 | 4697421..4697930 | - | 510 | WP_040190358.1 | GNAT family N-acetyltransferase | Toxin |
JMX54_RS23045 | 4697965..4698231 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
JMX54_RS23050 | 4698334..4699767 | - | 1434 | WP_048986922.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
JMX54_RS23055 | 4699757..4700440 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
JMX54_RS23060 | 4700613..4701998 | + | 1386 | WP_048986924.1 | efflux transporter outer membrane subunit | - |
JMX54_RS23065 | 4702016..4702360 | + | 345 | WP_048986926.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 170 a.a. Molecular weight: 18837.54 Da Isoelectric Point: 6.2333
>T291344 WP_040190358.1 NZ_LR890542:c4697930-4697421 [Klebsiella pneumoniae]
MIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQQKKIPYQN
APSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNLLFYPTKSI
EQLFTDDES
MIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQQKKIPYQN
APSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNLLFYPTKSI
EQLFTDDES
Download Length: 510 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z7SK09 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |