Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 65433..66034 Replicon plasmid 3
Accession NZ_LR890538
Organism Escherichia coli isolate MSB1_8B-sc-2280300

Toxin (Protein)


Gene name doc Uniprot ID U9Z1Q0
Locus tag JMX06_RS26615 Protein ID WP_001216047.1
Coordinates 65433..65813 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag JMX06_RS26620 Protein ID WP_001190712.1
Coordinates 65813..66034 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX06_RS26590 60873..62357 - 1485 WP_000124150.1 terminase -
JMX06_RS26595 62357..63550 - 1194 WP_032335092.1 hypothetical protein -
JMX06_RS26600 63637..64089 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
JMX06_RS26605 64178..65221 - 1044 WP_000644102.1 DUF968 domain-containing protein -
JMX06_RS26610 65249..65428 - 180 WP_000113019.1 hypothetical protein -
JMX06_RS26615 65433..65813 - 381 WP_001216047.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMX06_RS26620 65813..66034 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMX06_RS26625 66107..66496 - 390 WP_000506726.1 DNA repair protein -
JMX06_RS26630 66620..66871 - 252 WP_001283837.1 DNA polymerase III subunit theta -
JMX06_RS26635 67045..67254 + 210 WP_001344848.1 hypothetical protein -
JMX06_RS26640 67239..67523 - 285 WP_001142394.1 hypothetical protein -
JMX06_RS26645 67507..68445 - 939 WP_077266179.1 hypothetical protein -
JMX06_RS26650 68427..68801 - 375 WP_023356289.1 hypothetical protein -
JMX06_RS26655 68808..69101 - 294 WP_000269004.1 hypothetical protein -
JMX06_RS26660 69280..69513 - 234 WP_000516537.1 hypothetical protein -
JMX06_RS26665 69596..70459 - 864 WP_024946694.1 DUF551 domain-containing protein -
JMX06_RS26670 70793..70971 - 179 Protein_76 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..97184 97184


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13574.27 Da        Isoelectric Point: 5.1514

>T291334 WP_001216047.1 NZ_LR890538:c65813-65433 [Escherichia coli]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT291334 WP_001190712.1 NZ_LR890538:c66034-65813 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z1Q0

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References