Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 135808..136451 Replicon plasmid 2
Accession NZ_LR890537
Organism Escherichia coli isolate MSB1_8B-sc-2280300

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag JMX06_RS26185 Protein ID WP_001034044.1
Coordinates 136035..136451 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag JMX06_RS26180 Protein ID WP_001261286.1
Coordinates 135808..136038 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX06_RS26165 130945..131175 + 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMX06_RS26170 131172..131588 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
JMX06_RS26175 131633..135427 - 3795 WP_001144732.1 hypothetical protein -
JMX06_RS26180 135808..136038 + 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMX06_RS26185 136035..136451 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
JMX06_RS26190 136526..138091 + 1566 WP_001128474.1 AAA family ATPase -
JMX06_RS26195 138076..139098 + 1023 WP_000361402.1 helicase UvrD -
JMX06_RS26200 139352..140049 - 698 Protein_160 IS1 family transposase -
JMX06_RS26205 140405..141319 + 915 WP_000949004.1 iron/manganese ABC transporter substrate-binding protein SitA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid erm(B) / mph(A) / sul1 / qacE / aadA2 / dfrA12 / qepA4 / catA1 / tet(B) / sitABCD iucA / iucB / iucC / iucD / iutA 1..158162 158162
- flank IS/Tn sitABCD - 139352..143854 4502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T291333 WP_001034044.1 NZ_LR890537:136035-136451 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT291333 WP_001261286.1 NZ_LR890537:135808-136038 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References