Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 130945..131588 | Replicon | plasmid 2 |
Accession | NZ_LR890537 | ||
Organism | Escherichia coli isolate MSB1_8B-sc-2280300 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | C7S9Y5 |
Locus tag | JMX06_RS26170 | Protein ID | WP_001034046.1 |
Coordinates | 131172..131588 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | V0SR71 |
Locus tag | JMX06_RS26165 | Protein ID | WP_001261278.1 |
Coordinates | 130945..131175 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX06_RS26135 | 126456..126761 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
JMX06_RS26140 | 126763..126981 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
JMX06_RS26145 | 127548..128060 | + | 513 | WP_000151784.1 | hypothetical protein | - |
JMX06_RS26150 | 128094..129227 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
JMX06_RS26155 | 129394..130167 | - | 774 | WP_000905949.1 | hypothetical protein | - |
JMX06_RS26160 | 130180..130680 | - | 501 | WP_000528931.1 | hypothetical protein | - |
JMX06_RS26165 | 130945..131175 | + | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMX06_RS26170 | 131172..131588 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMX06_RS26175 | 131633..135427 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
JMX06_RS26180 | 135808..136038 | + | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
JMX06_RS26185 | 136035..136451 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(B) / mph(A) / sul1 / qacE / aadA2 / dfrA12 / qepA4 / catA1 / tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..158162 | 158162 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T291332 WP_001034046.1 NZ_LR890537:131172-131588 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9NXF9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SR71 |