Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
| Location | 4816235..4817223 | Replicon | chromosome |
| Accession | NZ_LR890536 | ||
| Organism | Escherichia coli isolate MSB1_8B-sc-2280300 | ||
Toxin (Protein)
| Gene name | panT | Uniprot ID | - |
| Locus tag | JMX06_RS23360 | Protein ID | WP_014640052.1 |
| Coordinates | 4816235..4816621 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | panA | Uniprot ID | A0A0A1AFM1 |
| Locus tag | JMX06_RS23365 | Protein ID | WP_000458583.1 |
| Coordinates | 4816651..4817223 (-) | Length | 191 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX06_RS23325 | 4811800..4812000 | - | 201 | WP_021527487.1 | helix-turn-helix domain-containing protein | - |
| JMX06_RS23330 | 4812091..4812765 | + | 675 | WP_021530636.1 | LexA family transcriptional regulator | - |
| JMX06_RS23335 | 4813433..4813795 | + | 363 | WP_000135680.1 | hypothetical protein | - |
| JMX06_RS23340 | 4813861..4814685 | + | 825 | WP_023908886.1 | DUF2303 family protein | - |
| JMX06_RS23345 | 4814904..4815656 | + | 753 | WP_024946495.1 | hypothetical protein | - |
| JMX06_RS23350 | 4815693..4815974 | + | 282 | WP_001093916.1 | pyocin activator PrtN family protein | - |
| JMX06_RS23355 | 4816022..4816195 | - | 174 | WP_023908888.1 | hypothetical protein | - |
| JMX06_RS23360 | 4816235..4816621 | - | 387 | WP_014640052.1 | hypothetical protein | Toxin |
| JMX06_RS23365 | 4816651..4817223 | - | 573 | WP_000458583.1 | SocA family protein | Antitoxin |
| JMX06_RS23370 | 4817459..4817581 | - | 123 | WP_001300034.1 | hypothetical protein | - |
| JMX06_RS23375 | 4817943..4818947 | - | 1005 | WP_022646425.1 | DUF2713 family protein | - |
| JMX06_RS23380 | 4819265..4819780 | + | 516 | WP_000416263.1 | zinc uptake transcriptional repressor Zur | - |
| JMX06_RS23385 | 4819822..4820031 | - | 210 | WP_001296638.1 | CsbD family protein | - |
| JMX06_RS23390 | 4820147..4821472 | - | 1326 | WP_001361471.1 | MATE family efflux transporter DinF | - |
| JMX06_RS23395 | 4821545..4822153 | - | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4774177..4822153 | 47976 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14465.40 Da Isoelectric Point: 5.4833
>T291324 WP_014640052.1 NZ_LR890536:c4816621-4816235 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
Download Length: 387 bp
Antitoxin
Download Length: 191 a.a. Molecular weight: 21956.30 Da Isoelectric Point: 6.0283
>AT291324 WP_000458583.1 NZ_LR890536:c4817223-4816651 [Escherichia coli]
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHDVLLRSDPREMDADEVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHDVLLRSDPREMDADEVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
Download Length: 573 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|