Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4589344..4589939 | Replicon | chromosome |
Accession | NZ_LR890536 | ||
Organism | Escherichia coli isolate MSB1_8B-sc-2280300 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | JMX06_RS22185 | Protein ID | WP_000239581.1 |
Coordinates | 4589344..4589694 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | JMX06_RS22190 | Protein ID | WP_001223213.1 |
Coordinates | 4589688..4589939 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX06_RS22165 | 4584799..4585821 | - | 1023 | WP_001550507.1 | ABC transporter permease | - |
JMX06_RS22170 | 4585835..4587337 | - | 1503 | WP_001550506.1 | sugar ABC transporter ATP-binding protein | - |
JMX06_RS22175 | 4587469..4588425 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
JMX06_RS22180 | 4588735..4589265 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
JMX06_RS22185 | 4589344..4589694 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
JMX06_RS22190 | 4589688..4589939 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
JMX06_RS22195 | 4590151..4590492 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
JMX06_RS22200 | 4590495..4594274 | - | 3780 | WP_022646473.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T291322 WP_000239581.1 NZ_LR890536:c4589694-4589344 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|