Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4577807..4578329 | Replicon | chromosome |
| Accession | NZ_LR890536 | ||
| Organism | Escherichia coli isolate MSB1_8B-sc-2280300 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A829L6G8 |
| Locus tag | JMX06_RS22125 | Protein ID | WP_001105433.1 |
| Coordinates | 4577807..4578097 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0SC69 |
| Locus tag | JMX06_RS22130 | Protein ID | WP_000212715.1 |
| Coordinates | 4578087..4578329 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX06_RS22110 | 4572975..4574630 | + | 1656 | WP_001550509.1 | alpha,alpha-phosphotrehalase | - |
| JMX06_RS22115 | 4575024..4577162 | + | 2139 | WP_032333766.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMX06_RS22120 | 4577342..4577806 | + | 465 | WP_001009182.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMX06_RS22125 | 4577807..4578097 | - | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX06_RS22130 | 4578087..4578329 | - | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMX06_RS22135 | 4578521..4578907 | - | 387 | WP_001232246.1 | cytochrome b562 | - |
| JMX06_RS22140 | 4579090..4580442 | - | 1353 | WP_032333765.1 | metalloprotease PmbA | - |
| JMX06_RS22145 | 4580536..4581087 | + | 552 | WP_000166270.1 | ribosome-associated protein | - |
| JMX06_RS22150 | 4581237..4582610 | - | 1374 | WP_001522402.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T291321 WP_001105433.1 NZ_LR890536:c4578097-4577807 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829L6G8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9H4B3 |