Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4478080..4478900 | Replicon | chromosome |
Accession | NZ_LR890536 | ||
Organism | Escherichia coli isolate MSB1_8B-sc-2280300 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | A0A0V9MKL8 |
Locus tag | JMX06_RS21615 | Protein ID | WP_001550554.1 |
Coordinates | 4478080..4478337 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | JMX06_RS21620 | Protein ID | WP_001519303.1 |
Coordinates | 4478349..4478900 (+) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX06_RS21595 | 4473366..4474472 | + | 1107 | WP_001519308.1 | N-acetylneuraminate epimerase | - |
JMX06_RS21600 | 4474537..4475517 | + | 981 | WP_001519307.1 | transposase | - |
JMX06_RS21605 | 4476100..4477341 | - | 1242 | Protein_4234 | DNA helicase | - |
JMX06_RS21610 | 4477404..4477703 | + | 300 | WP_001519304.1 | GNAT family N-acetyltransferase | - |
JMX06_RS21615 | 4478080..4478337 | + | 258 | WP_001550554.1 | hypothetical protein | Toxin |
JMX06_RS21620 | 4478349..4478900 | + | 552 | WP_001519303.1 | N-acetyltransferase | Antitoxin |
JMX06_RS21625 | 4478952..4479113 | + | 162 | WP_001519302.1 | hypothetical protein | - |
JMX06_RS21630 | 4479150..4479698 | + | 549 | WP_001519301.1 | hypothetical protein | - |
JMX06_RS21635 | 4479825..4480085 | + | 261 | WP_000084876.1 | hypothetical protein | - |
JMX06_RS21640 | 4480123..4480239 | + | 117 | Protein_4241 | VOC family protein | - |
JMX06_RS21645 | 4480484..4481605 | + | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
JMX06_RS21650 | 4481602..4481880 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
JMX06_RS21655 | 4481892..4483205 | + | 1314 | WP_001519300.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4470564..4479113 | 8549 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9744.33 Da Isoelectric Point: 11.0090
>T291320 WP_001550554.1 NZ_LR890536:4478080-4478337 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKPVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKPVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20463.61 Da Isoelectric Point: 6.8758
>AT291320 WP_001519303.1 NZ_LR890536:4478349-4478900 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCAQALMKPEHWRE
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|