Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3386786..3387491 | Replicon | chromosome |
Accession | NZ_LR890536 | ||
Organism | Escherichia coli isolate MSB1_8B-sc-2280300 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | JMX06_RS16290 | Protein ID | WP_000539521.1 |
Coordinates | 3386786..3387172 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JMX06_RS16295 | Protein ID | WP_001280945.1 |
Coordinates | 3387162..3387491 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX06_RS16270 | 3382790..3383416 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
JMX06_RS16275 | 3383413..3384528 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
JMX06_RS16280 | 3384639..3385022 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
JMX06_RS16285 | 3385235..3386560 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
JMX06_RS16290 | 3386786..3387172 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX06_RS16295 | 3387162..3387491 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
JMX06_RS16300 | 3387561..3388889 | - | 1329 | WP_022645414.1 | GGDEF domain-containing protein | - |
JMX06_RS16305 | 3388897..3391245 | - | 2349 | WP_022645413.1 | EAL domain-containing protein | - |
JMX06_RS16310 | 3391422..3392333 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T291314 WP_000539521.1 NZ_LR890536:3386786-3387172 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|