Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2693722..2694360 | Replicon | chromosome |
| Accession | NZ_LR890536 | ||
| Organism | Escherichia coli isolate MSB1_8B-sc-2280300 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | JMX06_RS12895 | Protein ID | WP_000813794.1 |
| Coordinates | 2694184..2694360 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | JMX06_RS12890 | Protein ID | WP_001270286.1 |
| Coordinates | 2693722..2694138 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX06_RS12870 | 2688874..2689815 | - | 942 | WP_022645667.1 | ABC transporter permease | - |
| JMX06_RS12875 | 2689816..2690829 | - | 1014 | WP_022645666.1 | ABC transporter ATP-binding protein | - |
| JMX06_RS12880 | 2690847..2691992 | - | 1146 | WP_000047466.1 | ABC transporter substrate-binding protein | - |
| JMX06_RS12885 | 2692237..2693643 | - | 1407 | WP_022645665.1 | PLP-dependent aminotransferase family protein | - |
| JMX06_RS12890 | 2693722..2694138 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| JMX06_RS12895 | 2694184..2694360 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| JMX06_RS12900 | 2694582..2694812 | + | 231 | WP_000491567.1 | DUF2554 family protein | - |
| JMX06_RS12905 | 2694904..2696865 | - | 1962 | WP_023909195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| JMX06_RS12910 | 2696938..2697474 | - | 537 | WP_000429148.1 | DNA-binding transcriptional regulator SutR | - |
| JMX06_RS12915 | 2697527..2698738 | + | 1212 | WP_071788120.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T291312 WP_000813794.1 NZ_LR890536:c2694360-2694184 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT291312 WP_001270286.1 NZ_LR890536:c2694138-2693722 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|