Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 65312..66048 | Replicon | plasmid 3 |
| Accession | NZ_LR890529 | ||
| Organism | Klebsiella pneumoniae isolate INF361-sc-2280198 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
| Locus tag | JMW73_RS26255 | Protein ID | WP_004187044.1 |
| Coordinates | 65312..65794 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMW73_RS26260 | Protein ID | WP_003026799.1 |
| Coordinates | 65782..66048 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW73_RS26230 | 61337..62273 | - | 937 | Protein_56 | ISNCY family transposase | - |
| JMW73_RS26235 | 62383..62553 | + | 171 | Protein_57 | transposase | - |
| JMW73_RS26240 | 62551..62658 | + | 108 | Protein_58 | IS3 family transposase | - |
| JMW73_RS26245 | 62891..63595 | - | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
| JMW73_RS26250 | 63755..65101 | - | 1347 | WP_077251107.1 | ISNCY family transposase | - |
| JMW73_RS26255 | 65312..65794 | - | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
| JMW73_RS26260 | 65782..66048 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMW73_RS26265 | 66199..66903 | + | 705 | WP_060579418.1 | IS6-like element IS26 family transposase | - |
| JMW73_RS26270 | 67062..69647 | - | 2586 | WP_004187040.1 | EAL domain-containing protein | - |
| JMW73_RS26275 | 69616..69861 | - | 246 | WP_032238678.1 | hypothetical protein | - |
| JMW73_RS26280 | 69919..70899 | - | 981 | Protein_66 | IS5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | mrkA / mrkB / mrkC / mrkF / mrkJ | 1..134665 | 134665 | |
| - | inside | IScluster/Tn | - | - | 60174..70899 | 10725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T291299 WP_004187044.1 NZ_LR890529:c65794-65312 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|